



This photo was viewed 1 times and was downloaded in full size 0 times.

This photo was liked 0 times

Please login in order to see the source link


English: University of Cooperative Science Villingen-Schwenningen
Deutsch: Berufsakademie Villingen-Schwenningen
Date 07.09.2006
Source Berufsakademie Villingen-Schwenningen
Author Berufsakademie Villingen-Schwenningen


GNU head Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.2 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts. A copy of the license is included in the section entitled GNU Free Documentation License.

w:en:Creative Commons
attribution share alike
This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license.
You are free:
  • to share – to copy, distribute and transmit the work
  • to remix – to adapt the work
Under the following conditions:
  • attribution – You must attribute the work in the manner specified by the author or licensor (but not in any way that suggests that they endorse you or your use of the work).
  • share alike – If you alter, transform, or build upon this work, you may distribute the resulting work only under the same or similar license to this one.
This licensing tag was added to this file as part of the GFDL licensing update.

GNU Free Documentation License


Only registered users can post comments. Please login

EXIF data:
File name berufsakademievillingenschwenningen.jpg
Size, bytes 300124
Mime type image/jpeg
Camera manufacturer Canon
Camera model Canon PowerShot G2
Orientation of image 1
Image resolution in width direction 180/1
Image resolution in height direction 180/1
Unit of X and Y resolution 2
Exposure time 1/100
F number 56/10
Compressed bits per pixel 5/1
Exif version 0220
Lens focal length 224/32
Date and time original image was generated 2006:09:07 12:54:27
Date and time image was made digital data 2006:09:07 12:54:27
Meaning of each component 
Shutter speed 213/32
Aperture 159/32
Exposure bias 0/3
Maximum lens aperture 131072/65536
Metering mode 5
User comments
Supported Flashpix version 0100
Color space information 1
Exif image width 2272
Exif image length 1704
InteroperabilityOffset 1416
Focal plane X resolution 2272000/280
Focal plane Y resolution 1704000/210
Focal plane resolution unit 2
Sensing method 2
Digital zoom ratio 2272/2272
Interoperability index R98
Interoperability version 0100
Type of image IMG:PowerShot G2 JPEG
Firmware version Firmware Version 1.10
Image number 1434394
The images at Free-Photos.biz come mainly from Wikimedia Commons or from our own production. The photos are either in the public domain, or licensed under free linceses: Free-Photos.biz license, GPL, Creative Commons or Free-Art license. Some very few other photos where uploaded to Free-Photos.biz by our users and released into the public domain or into free usage under another free license (like GPL etc.)

All photos in average size can be saved by everyone without registration (by right-clicking) - and all photos can be downloaded in full-size and without the big watermark by members (by left-clicking) (registration and free membership required).

While the copyright and licensing information supplied for each photo is believed to be accurate, Free-Photos.biz does not provide any warranty regarding the copyright status or correctness of licensing terms. If you decide to reuse the images from Free-Photos.biz, you should verify the copyright status of each image just as you would when obtaining images from other sources.

The use of depictions of living or deceased persons may be restricted in some jurisdictions by laws regarding personality rights. Such images are exhibited at Free-Photos.biz as works of art that serve higher artistic interests.

christianity portal